DR1885-like metal-binding protein (b.2.10.1)


SCOP classification
 
Class: All beta proteins
Fold: Common fold of diphtheria toxin/transcription factors/cytochrome f
Superfamily: DR1885-like metal-binding protein
Family: DR1885-like metal-binding protein



Orphan Member
 
Domain: d2jqaa1 of protein: Hypothetical protein DR1885 from Species: Deinococcus radiodurans [TaxId: 1299]




>2jqaa1(b.2.10.1)
MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSGGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)