Bacterial chitobiase, n-terminal domain (b.2.2.3)


SCOP classification
 
Class: All beta proteins
Fold: Common fold of diphtheria toxin/transcription factors/cytochrome f
Superfamily: Carbohydrate-binding domain
Family: Bacterial chitobiase, n-terminal domain



Orphan Member
 
Domain: d1qbba2 of protein: Bacterial chitobiase, n-terminal domain from Species: Serratia marcescens [TaxId: 615]




>1c7sa2(b.2.2.3)
DQQLVDQLSQLKLNVKMLDNRAGENGVDCAALGADWASCNRVLFTLSNDGQAIDGKDWVIYFHSPRQTLRVDNDQFKIAHLTGDLYKLEPTAKFSGFPAGKAVEIPVVAEYWQLFRNDFLPRWYATSGDAKPKMLANTDTENLDQFVAPFTGDQWKRTKDDKNILMTPASRFV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)