SO2946-like (b.29.1.24)


SCOP classification
 
Class: All beta proteins
Fold: Concanavalin A-like lectins/glucanases
Superfamily: Concanavalin A-like lectins/glucanases
Family: SO2946-like



Orphan Member
 
Domain: d2a5zc_ of protein: Hypothetical protein SO2946 from Species: Shewanella oneidensis [TaxId: 70863]




>2a5zc1(b.29.1.24)
TTPGLMSPSEKLKLSTLTTSIATSDFYASYDFMMHSIGLTSANNISLLSTGNISLQNILSEGNHFGVQPIVSSTTANASFLAGMLMAIFPKESELEVTVYFKTPSAFNPAQLTVIGSTSIGLGISDRSGLIIENGNAFGGIVKASAATETGSTYALSTSTWYICKFKMLTDDRFKVTLYSDSGTQLYSYTSTAAMFRADNATAHIGFKTQCKTATAGISLISIDLIEFKAKVSATRAKV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)