automated matches (b.31.1.0)


SCOP classification
 
Class: All beta proteins
Fold: EV matrix protein
Superfamily: EV matrix protein
Family: automated matches



Orphan Member
 
Domain: d3tcqa2 of protein: automated matches from Species: Sudan ebolavirus [TaxId: 128948]




>d3tcqa2|b.31.1.0
RPGLSFHPKLRPVLLPGTAPDKIQTIVNLMQDFKIVPIDPAKSIIGIEVPELLVHKLTGK
KMSQKNGQPIIPVLLPKYIGPGDLTMVIT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)