automated matches (b.34.11.0)


SCOP classification
 
Class: All beta proteins
Fold: SH3-like barrel
Superfamily: Prokaryotic SH3-related domain
Family: automated matches



Orphan Member
 
Domain: d2hbwa1 of protein: automated matches from Species: Anabaena variabilis [TaxId: 240292]




>d2hbwa1|b.34.11.0
SGEYQCLAALNLYDSPECTSLATQAAVGRHLQVTSNQQGAAVEVCLCEDDYPGWLSLGDL
GLLKPATVLYQAK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)