Spr N-terminal domain-like (b.34.11.3)


SCOP classification
 
Class: All beta proteins
Fold: SH3-like barrel
Superfamily: Prokaryotic SH3-related domain
Family: Spr N-terminal domain-like



Orphan Member
 
Domain: d2fg0b1 of protein: Cell wall-associated hydrolase Spr N-terminal domain from Species: Nostoc punctiforme [TaxId: 272131]




>2evra1(b.34.11.3)
KLGEYQCLADLNLFDSPECTRLATQSASGRHLWVTSNHQNLAVEVYLCEDDYPGWLSLSDFDSLQPATVPYQAA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)