Ply C-terminal domain-like (b.34.11.4)


SCOP classification
 
Class: All beta proteins
Fold: SH3-like barrel
Superfamily: Prokaryotic SH3-related domain
Family: Ply C-terminal domain-like



Orphan Member
 
Domain: d1xova1 of protein: Endolysin Ply, C-terminal domain from Species: Bacteriophage Psa [TaxId: 171618]




>1xova1(b.34.11.4)
PNRHSGAVVDSVPMLSKMDFKSSPIKMYKAGSSLLVYEHNKYWYKAYINDKLCYIYKSFCISNGKKDAKGRIKVRIKSAKDLRIPVWNNTKLNSGKIKWYSPGTKLSWYDNKKGYLELWYEKDGWYYTANYFLK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)