Kinase-associated protein B-like (b.34.16.1)


SCOP classification
 
Class: All beta proteins
Fold: SH3-like barrel
Superfamily: Kinase-associated protein B-like
Family: Kinase-associated protein B-like



Orphan Member
 
Domain: d1y71b_ of protein: Kinase-associated protein B from Species: Bacillus cereus [TaxId: 1396]




>1y71b1(b.34.16.1)
TFEIGEIVTGIYKTGKYIGEVTNSRPGSYVVKVLAVLKHPVQGFHERRALAFREQTNIPEQMVKKYEGEIPDYTESLKLALETQMNSFSEDDSPFAERSLETLQQLKKDYKL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)