R67 dihydrofolate reductase (b.34.4.1)


SCOP classification
 
Class: All beta proteins
Fold: SH3-like barrel
Superfamily: Electron transport accessory proteins
Family: R67 dihydrofolate reductase



Orphan Member
 
Domain: d3sfma_ of protein: automated matches from Species: Escherichia coli [TaxId: 562]




>2gqva1(b.34.4.1)
SNATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERIN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)