Rv2302-like (b.34.6.3)


SCOP classification
 
Class: All beta proteins
Fold: SH3-like barrel
Superfamily: Cell growth inhibitor/plasmid maintenance toxic component
Family: Rv2302-like



Orphan Member
 
Domain: d2a7ya1 of protein: Hypothetical protein Rv2302/MT2359 from Species: Mycobacterium tuberculosis [TaxId: 1773]




>2a7ya1(b.34.6.3)
MHAKVGDYLVVKGTTTERHDQHAEIIEVRSADGSPPYVVRWLVNGHETTVYPGSDAVVVTATEHAEAEKRAAARAGHAAT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)