Fumarylacetoacetate hydrolase, FAH, N-terminal domain (b.34.8.1)


SCOP classification
 
Class: All beta proteins
Fold: SH3-like barrel
Superfamily: Fumarylacetoacetate hydrolase, FAH, N-terminal domain
Family: Fumarylacetoacetate hydrolase, FAH, N-terminal domain



Orphan Member
 
Domain: d2hzyb1 of protein: Fumarylacetoacetate hydrolase, FAH, N-terminal domain from Species: Mouse (Mus musculus) [TaxId: 10090]




>1hyoa1(b.34.8.1)
MSFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKHLFTGPALSKHQHVFDETTLNNFMGLGQAAWKEARASLQNLLSASQARLRDDKELRQRAFTSQASATMHLP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)