MTH1368 C-terminal domain-like (b.36.1.6)


SCOP classification
 
Class: All beta proteins
Fold: PDZ domain-like
Superfamily: PDZ domain-like
Family: MTH1368 C-terminal domain-like



Orphan Member
 
Domain: d2hgaa1 of protein: Uncharacterized protein MTH1368 from Species: Methanobacterium thermoautotrophicum [TaxId: 145262]




>d2hgaa1|b.36.1.6
QPDGVQIDSVVPGSPASKVLTPGLVIESINGMPTSNLTTYSAALKTISVGEVINITTDQG
TFHLKTGRNPNNSSRAYMGIRTSNHLRVRDSVASVLGDTLPFA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)