TrmB C-terminal domain-like (b.38.5.1)


SCOP classification
 
Class: All beta proteins
Fold: Sm-like fold
Superfamily: TrmB C-terminal domain-like
Family: TrmB C-terminal domain-like



Orphan Member
 
Domain: d2f5tx1 of protein: Transcriptional regulator TrmB from Species: Thermococcus litoralis [TaxId: 2265]




>d2f5tx1|b.38.5.1
NPKDIRFFAMFHAVDFVKNHLKNRNIYAEITGKNLESGRLETLTGRVVGYTLSLREAVNN
IHLETENGVVKVGGMFAVIEDYESTEIKFIMG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)