NfeD domain-like (b.40.12.1)


SCOP classification
 
Class: All beta proteins
Fold: OB-fold
Superfamily: NfeD domain-like
Family: NfeD domain-like



Orphan Member
 
Domain: d2exda1 of protein: Hypothetical protein PH0471 from Species: Pyrococcus horikoshii [TaxId: 53953]




>2exda1(b.40.12.1)
RRETTDIGGGKYTFELKGKVGKVVKIAEDHYLVEVEGDKWIAYSDEKLSLGDRVMVVDVDGLKLKVKRIPPQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)