Hypothetical protein MTH1 (MT0001), insert domain (b.40.4.10)


SCOP classification
 
Class: All beta proteins
Fold: OB-fold
Superfamily: Nucleic acid-binding proteins
Family: Hypothetical protein MTH1 (MT0001), insert domain



Orphan Member
 
Domain: d1k3rb1 of protein: Hypothetical protein MTH1 (MT0001), insert domain from Species: Methanobacterium thermoautotrophicum [TaxId: 145262]




>1k3rb1(b.40.4.10)
PHHPTGKPVTGEYRQGLTVKRVKKGTLVDIGADKLALCREKLTVNRIMSFRVVRLGKEILIEPDEPEDRYW

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)