DNA replication initiator (cdc21/cdc54) N-terminal domain (b.40.4.11)


SCOP classification
 
Class: All beta proteins
Fold: OB-fold
Superfamily: Nucleic acid-binding proteins
Family: DNA replication initiator (cdc21/cdc54) N-terminal domain



Orphan Member
 
Domain: d1ltlf_ of protein: DNA replication initiator (cdc21/cdc54) N-terminal domain from Species: Methanobacterium thermoautotrophicum [TaxId: 145262]




>1ltlf_(b.40.4.11)
VDKSKTLTKFEEFFSLQDYKDRVFEAIEKYPNVRSIEVDYLDLEMFDPDLADLLIEKPDDVIRAAQQAIRNIDRLRKNVDLNIRFSGISNVIPLRELRSKFIGKFVAVDGIVRKTDEIRPRIVKAVFECRGCMRHHAVTQSTNMITEPSLCSECGGRSFRLLQDESEFLDTQTLKLQEPLENLSGGEQPRQITVVLEDDLVDTLTPGDIVRVTGTLRTVRDERTKRFKNFIYGNYTEFL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)