gp4 N-terminal domain-like (b.40.8.1)


SCOP classification
 
Class: All beta proteins
Fold: OB-fold
Superfamily: gp5 N-terminal domain-like
Family: gp4 N-terminal domain-like



Orphan Member
 
Domain: d2p5zx1 of protein: Hypothetical protein c3393 from Species: Escherichia coli o6 [TaxId: 217992]




>1k28a1(b.40.8.1)
NNLNWFVGVVEDRMDPLKLGRVRVRVVGLHPPQRAQGDVMGIPTEKLPWMSVIQPITSAAMSGIGGSVTGPVEGTRVYGHFLDKWKTNGIVLGTYGGIVREKPNRLEGFSDPTGQYPRRLGNDT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)