RIKEN cDNA 2310057j16 protein (KIAA1543) (b.41.1.3)


SCOP classification
 
Class: All beta proteins
Fold: PRC-barrel domain
Superfamily: PRC-barrel domain
Family: RIKEN cDNA 2310057j16 protein (KIAA1543)



Orphan Member
 
Domain: d1ugja_ of protein: RIKEN cDNA 2310057j16 protein (KIAA1543) from Species: Mouse (Mus musculus) [TaxId: 10090]




>1ugja_(b.41.1.3)
GSSGSSGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKSGPSSG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)