RimM C-terminal domain-like (b.41.1.4)


SCOP classification
 
Class: All beta proteins
Fold: PRC-barrel domain
Superfamily: PRC-barrel domain
Family: RimM C-terminal domain-like



Orphan Member
 
Domain: d2f1la1 of protein: 16S rRNA processing protein RimM, C-terminal domain from Species: Pseudomonas aeruginosa [TaxId: 287]




>2f1la1(b.41.1.4)
YYWHQLEGLKVIDQGRQLLGVIDHLLETGANDVMVVKPCAGSLDDRERLLPYTGQCVLSIDLAAGEMRVDWDADF

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)