YkvR-like (b.45.3.1)


SCOP classification
 
Class: All beta proteins
Fold: Split barrel-like
Superfamily: YkvR-like
Family: YkvR-like



Orphan Member
 
Domain: d2jn9a1 of protein: Uncharacterized protein YkvR from Species: Bacillus subtilis [TaxId: 1423]




>d2jn9a1|b.45.3.1
VKTLRLNNVTLEMAAYQEESEPKRKIAFTLNVTSETYHDIAVLLYEKTFNVEVPERDLAF
RGEMTNYSTSLTNLYEPGAVSEFYIEITEIDKNADS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)