Pollen allergen PHL P 1 N-terminal domain (b.52.1.3)


SCOP classification
 
Class: All beta proteins
Fold: Double psi beta-barrel
Superfamily: Barwin-like endoglucanases
Family: Pollen allergen PHL P 1 N-terminal domain



Orphan Member
 
Domain: d1n10b2 of protein: Pollen allergen PHL P 1 N-terminal domain from Species: Timothy grass (Phleum pratense) [TaxId: 15957]




>1n10b2(b.52.1.3)
PKVPPGPNITATYGDKWLDAKSTWYGGGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLRSAGELELQFRRVKCKYPEG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)