SSRP1-like (b.55.1.10)


SCOP classification
 
Class: All beta proteins
Fold: PH domain-like barrel
Superfamily: PH domain-like
Family: SSRP1-like



Orphan Member
 
Domain: d4pq0a_ of protein: automated matches from Species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]




>2gclb1(b.55.1.10)
AGDAIVSFQDVFFTTPRGRYDIDIYKNSIRLRGKTYEYKLQHRQIQRIVSLPKADDIHHMMVMAIEPPLRQGQTTYPFLVLQFQKDEETEVQLNLEDEDYEENYKDKLKKQYDAKTHIVLSHVLKGLTDRRVIVPGEYKSKYDQCAVSCSFKANEGYLYPLDNAFFFLTKPTLYIPFSDVSMVNISRARTFDLEVVLRSNRGSTTFANISKEEQQLLEQFLKSKNLRVKN

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)