PA2021-like (b.55.2.1)


SCOP classification
 
Class: All beta proteins
Fold: PH domain-like barrel
Superfamily: PA2021-like
Family: PA2021-like



Orphan Member
 
Domain: d1ywya1 of protein: Hypothetical protein PA2021 from Species: Pseudomonas aeruginosa [TaxId: 287]




>1ywya1(b.55.2.1)
MSIEIDSEQGVCSVEIEGSRHRAPVDSLRIGTDAEARLSVLYIDGKRLHISEEDAQRLVVAGAEDQRRHLMADD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)