Peptidylarginine deiminase Pad4, N-terminal domain (b.6.1.6)


SCOP classification
 
Class: All beta proteins
Fold: Cupredoxin-like
Superfamily: Cupredoxins
Family: Peptidylarginine deiminase Pad4, N-terminal domain



Orphan Member
 
Domain: d4dkta1 of protein: Peptidylarginine deiminase Pad4, N-terminal domain from Species: Human (Homo sapiens) [TaxId: 9606]




>2dexx2(b.6.1.6)
GTLIRVTPEQPTHAVCVLGTLTQLDICSSAPTSFSINASPGVVVDITWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYLTA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)