Hypothetical protein YwiB (b.60.1.5)


SCOP classification
 
Class: All beta proteins
Fold: Lipocalins
Superfamily: Lipocalins
Family: Hypothetical protein YwiB



Orphan Member
 
Domain: d1r0ua_ of protein: Hypothetical protein YwiB from Species: Bacillus subtilis [TaxId: 1423]




>1r0ua_(b.60.1.5)
GFQSNAMKQETPITLHVKSVIEDDGNQEVIEFRTTGFYYVKQNKVYLSYYEEHDLGKVKTIVKVSEGEVLVMRSGAVKMNQRFVTGASTIAKYKMSFGELELKTSTKSIQSDLDEEKGRISIAYDMHVGHLHNMTITYEGGT

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)