Phenolic acid decarboxylase (PAD) (b.60.1.6)


SCOP classification
 
Class: All beta proteins
Fold: Lipocalins
Superfamily: Lipocalins
Family: Phenolic acid decarboxylase (PAD)



Orphan Member
 
Domain: d3nadb_ of protein: automated matches from Species: Bacillus pumilus [TaxId: 1408]




>2gc9a1(b.60.1.6)
MTKTFKTLDDFLGTHFIYTYDNGWEYEWYAKNDHTVDYRIHGGMVAGRWVTDQKADIVMLTEGIYKISWTEPTGTDVALDFMPNEKKLHGTIFFPKWVEEHPEITVTYQNEHIDLMEQSREKYATYPKLVVPEFANITYMGDAGQNNEDVISEAPYKEMPNDIRNGKYFDQNYHRLNK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)