Dinoflagellate luciferase repeat (b.60.1.7)


SCOP classification
 
Class: All beta proteins
Fold: Lipocalins
Superfamily: Lipocalins
Family: Dinoflagellate luciferase repeat



Orphan Member
 
Domain: d1vpra1 of protein: Dinoflagellate luciferase from Species: Lingulodinium polyedrum [TaxId: 160621]




>1vpra1(b.60.1.7)
EKGFEAGDNKLGGALNAKHVEKYGDNFKNGMHKPEFHEDGLHKPMEVGGKKFESGFHYLLECHELGGKNASGGYGGPLCEDPYGSEVQAMTEKLLKEADSDRTLCFNNFQDPCPQLTKEQVAMCKGFDYGDKTLKLPCGPLPWPAGLPEPGYVPKTNPLHGRWITVSGGQAAFIKEAIKSGMLGAAEANKIVADTDHHQTGGMYLRINQFGDVCTVDASVAKFARAKRTWKSGHYFYEPLVSGGNLLGVWVLPEEYRKIGFFWEMESGRCFRIERRAFPVGPYTFMRQATEVGGKISFVFYVKVSNDPESDPIPLQSRDYTALAGRDNAPTNLGKPYPTLAKDLDYPKKRD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)