YdhA-like (b.61.8.1)


SCOP classification
 
Class: All beta proteins
Fold: Streptavidin-like
Superfamily: YdhA-like
Family: YdhA-like



Orphan Member
 
Domain: d2f09a1 of protein: Hypothetical protein YdhA from Species: Escherichia coli [TaxId: 562]




>2f09a1(b.61.8.1)
MQTDTLEYQCDEKPLTVKLNNPRQEVSFVYDNQLLHLKQGISASGARYTDGIYVFWSKGDEATVYKRDRIVLNNCQLQNPQR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)