TM1225-like predicted glycosylases (b.67.2.4)


SCOP classification
 
Class: All beta proteins
Fold: 5-bladed beta-propeller
Superfamily: Arabinanase/levansucrase/invertase
Family: TM1225-like predicted glycosylases



Orphan Member
 
Domain: d1vkdf_ of protein: Hypothetical protein TM1225 from Species: Thermotoga maritima [TaxId: 2336]




>1vkde_(b.67.2.4)
MKVFTEKIPNIPWEERPEGYTGPVWRYSKNPIIGRNPVPKGARVFNSAVVPYNGEFVGVFRIDHKNTRPFLHFGRSKDGINWEIEPEEIQWVDVNGEPFQPSYAYDPRVVKIEDTYYITFCTDDHGPTIGVGMTKDFKTFVRLPNAYVPFNRNGVLFPRKINGKYVMLNRPSDNGHTPFGDIFLSESPDMIHWGNHRFVLGRSSYNWWENLKIGAGPYPIETSEGWLLIYHGVTLTCNGYVYSFGAALLDLDDPSKVLYRSRYYLLTPEEEYETVGFVPNVVFPCAALCDADTGRVAIYYGAADTHVALAFGYIDEIVDFVKRNS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)