LmjF10.1260-like (b.67.2.5)


SCOP classification
 
Class: All beta proteins
Fold: 5-bladed beta-propeller
Superfamily: Arabinanase/levansucrase/invertase
Family: LmjF10.1260-like



Orphan Member
 
Domain: d2b4wa1 of protein: Hypothetical protein LmjF10.1260 from Species: Leishmania major [TaxId: 5664]




>2b4wa1(b.67.2.5)
KQVKAAFEANKRVYESVLLTFKGVDGYDVYNCSVPFSYKGKTHIYGRVEKRDIWAASHVRLFEETGKDEFTAVPELSWELEDPYIAKINNEMIFGGTRVRILSYYGYFYRGTPDELTYFTRGPGCMKDIRVLQLQDGRLGVFSRPRVASIGFVILNSIDELGAEVIAKAPPLDILNAWGGVNQAYLLSSGKVGCIGHYSYEQSVYVNYAFVLDPQSRAITGAKIIGTKSCYPPCEPKVPLLADCVFASGIVMRSDGKVDLYSGVGDSHEGRITIDYPFKGHGTIIGDLHFPM

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)