TolB, C-terminal domain (b.68.4.1)


SCOP classification
 
Class: All beta proteins
Fold: 6-bladed beta-propeller
Superfamily: TolB, C-terminal domain
Family: TolB, C-terminal domain



Orphan Member
 
Domain: d3iaxa2 of protein: automated matches from Species: Escherichia coli [TaxId: 562]




>2hqsf1(b.68.4.1)
AFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQVASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGGQQHIAKQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATDGQVKFPAWSPYL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)