YVTN repeat (b.69.2.3)


SCOP classification
 
Class: All beta proteins
Fold: 7-bladed beta-propeller
Superfamily: YVTN repeat-like/Quinoprotein amine dehydrogenase
Family: YVTN repeat



Orphan Member
 
Domain: d1l0qd2 of protein: Surface layer protein from Species: Methanosarcina mazei [TaxId: 2209]




>1l0qd2(b.69.2.3)
STFAYIANSESDNISVIDVTSNKVTATIPVGSNPMGAVISPDGTKVYVANAHSNDVSIIDTATNNVIATVPAGSSPQGVAVSPDGKQVYVTNMASSTLSVIDTTSNTVAGTVKTGKSPLGLALSPDGKKLYVTNNGDKTVSVINTVTKAVINTVSVGRSPKGIAVTPDGTKVYVANFDSMSISVIDTVTNSVIDTVKVEAAPSGIAVNPEGTKAYVTNVDKYFNTVSMIDTGTNKITARIPVGPDPAGIAVTPDGKKVYVALSFNTVSVIDTATNTITATMAVGKNPYASGQFIGSIPVQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)