Smr-associated domain (b.7.5.1)


SCOP classification
 
Class: All beta proteins
Fold: C2 domain-like
Superfamily: Smr-associated domain-like
Family: Smr-associated domain



Orphan Member
 
Domain: d2huha1 of protein: Putative DNA mismatch repair protein BT2179 from Species: Bacteroides thetaiotaomicron [TaxId: 818]




>d2huha1|b.7.5.1
RQPEVRGGDTLNVFLAYVPEDAKATTPFEAYLVNDSNYYLYYTYLSAEGKAWNNRSHGLV
EPNTKLLLEEFTKDVLNEERVAVQLIAFKDGKPAAIKPAVSVELRIDTVKFYKLHTFSAS
DFFEEPALIYDIVKDDVPAKQVYV

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)