Putative glucosidase YicI, domain 3 (b.71.1.4)


SCOP classification
 
Class: All beta proteins
Fold: Glycosyl hydrolase domain
Superfamily: Glycosyl hydrolase domain
Family: Putative glucosidase YicI, domain 3



Orphan Member
 
Domain: d2f2hf3 of protein: Putative glucosidase YicI, domain 3 from Species: Escherichia coli [TaxId: 562]




>2f2hf3(b.71.1.4)
PMMRAMMMEFPDDPACDYLDRQYMLGDNVMVAPVFTEAGDVQFYLPEGRWTHLWHNDELDGSRWHKQQHGFLSLPVYVRD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)