Beta-galactosidase LacA, domain 2 (b.71.1.5)


SCOP classification
 
Class: All beta proteins
Fold: Glycosyl hydrolase domain
Superfamily: Glycosyl hydrolase domain
Family: Beta-galactosidase LacA, domain 2



Orphan Member
 
Domain: d1xc6a4 of protein: Beta-galactosidase LacA, domain 2 from Species: Penicillium sp. [TaxId: 5081]




>1tg7a4(b.71.1.5)
GYLVANPGDLSTSTYTNTADLTVTPLLGSNSSASSFFVIRHSDYSSQASVEYKLTVPTSAGNLTIPQLGGSLTLSGRDSKIHVTDYDVAGTNILYSTAEVFTWKKFNNEKVLVLYGGPGEHHEFAVSGASSSSVVEGSSSGISSKKVGKALVVAWDVSTARRIVQVGSLKVFLLD

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)