Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain (b.72.3.1)


SCOP classification
 
Class: All beta proteins
Fold: WW domain-like
Superfamily: Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain
Family: Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain



Orphan Member
 
Domain: d1rk8c_ of protein: Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain from Species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]




>1rk8c_(b.72.3.1)
TYLQSSEGKFIPATKRPDGTWRKARRVKDGYVP

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)