Filamentous hemagglutinin FhaB, secretion domain (b.80.1.11)


SCOP classification
 
Class: All beta proteins
Fold: Single-stranded right-handed beta-helix
Superfamily: Pectin lyase-like
Family: Filamentous hemagglutinin FhaB, secretion domain



Orphan Member
 
Domain: d1rwra_ of protein: Filamentous hemagglutinin FhaB, secretion domain from Species: Bordetella pertussis [TaxId: 520]




>1rwra_(b.80.1.11)
QGLVPQGQTQVLQGGNKVPVVNIADPNSGGVSHNKFQQFNVANPGVVFNNGLTDGVSRIGGALTKNPNLTRQASAILAEVTDTSPSRLAGTLEVYGKGADLIIANPNGISVNGLSTLNASNLTLTTGRPSVNGGRIGLDVQQGTVTIERGGVNATGLGYFDVVARLVKLQGAVSSKQGKPLADIAVVAGANRYDHATRRATPIAAGARGAAAGAYAIDGTAAGAMYGKHITLVSSDSGLGVRQLGSLSSPSAITVSSQGEIALGDATVQRGPLSLKGAGVVSAGKLASGGGAVNVAG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)