Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain (b.81.4.1)


SCOP classification
 
Class: All beta proteins
Fold: Single-stranded left-handed beta-helix
Superfamily: Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain
Family: Guanosine diphospho-D-mannose pyrophosphorylase/mannose-6-phosphate isomerase linker domain



Orphan Member
 
Domain: d2cu2a1 of protein: Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 from Species: Thermus thermophilus [TaxId: 274]




>d2cu2a1|b.81.4.1
DPHENVVLGEGRHVALDTFGCVVYADRGVVATLGVSGLVVAKVGDEVLVVPKDWAREVRE
VVKRLEA

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)