Probable transcriptional regulator VC1968, C-terminal domain (b.82.1.15)


SCOP classification
 
Class: All beta proteins
Fold: Double-stranded beta-helix
Superfamily: RmlC-like cupins
Family: Probable transcriptional regulator VC1968, C-terminal domain



Orphan Member
 
Domain: d1y9qa2 of protein: Probable transcriptional regulator VC1968, C-terminal domain from Species: Vibrio cholerae [TaxId: 666]




>1y9qa2(b.82.1.15)
SFPDDLNMKIHTLFPYAADTGLEIFEITLLDHHQQMSSPHALGVIEYIHVLEGIMKVFFDEQWHELQQGEHIRFFSDQPHGYAAVTEKAVFQNIVAYPR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)