PA5104-like (b.82.1.17)


SCOP classification
 
Class: All beta proteins
Fold: Double-stranded beta-helix
Superfamily: RmlC-like cupins
Family: PA5104-like



Orphan Member
 
Domain: d1ylld_ of protein: automated matches from Species: Pseudomonas aeruginosa [TaxId: 208964]




>1ylld1(b.82.1.17)
ELRILRAVDYPRMPWKNGAGSTEEIARDGGDGLDGFGWRLSIADVGESGGFSGFAGYQRIISVLEGGGMRLRVDGAESAPLRARQAFAFSGDSEVHCTLLDGAIRDFNLIYAPRRHRARLQWLRVEGELDWHGTASTLLLFAQQDGVAISLQGQPRGQLAAHDCLCAEGLQGLQHWRLTAHEPAWVCAVELDSL

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)