L-rhamnose isomerase (c.1.15.2)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: TIM beta/alpha-barrel
Superfamily: Xylose isomerase-like
Family: L-rhamnose isomerase



Orphan Member
 
Domain: d1de6d_ of protein: L-rhamnose isomerase from Species: Escherichia coli [TaxId: 562]




>1d8wc_(c.1.15.2)
TQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFEYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVEWAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPSVMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVGSNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVLLDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAELRKLEAPGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)