Hypothetical protein YgbM (EC1530) (c.1.15.5)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: TIM beta/alpha-barrel
Superfamily: Xylose isomerase-like
Family: Hypothetical protein YgbM (EC1530)



Orphan Member
 
Domain: d1k77a_ of protein: Hypothetical protein YgbM (EC1530) from Species: Escherichia coli [TaxId: 562]




>1k77a_(c.1.15.5)
MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYNYSTLQIQKQLEQNHLTLALFNTAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVKPHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYPWLFRLFDEVGYQGWIGCEYKPRGLTEEGLGWFDAWRGS

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)