KguE-like (c.1.15.7)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: TIM beta/alpha-barrel
Superfamily: Xylose isomerase-like
Family: KguE-like



Orphan Member
 
Domain: d1yx1c_ of protein: Hypothetical protein PA2260 from Species: Pseudomonas aeruginosa [TaxId: 287]




>1yx1c1(c.1.15.7)
LHPVSISLSSYGADLVRSRGQASFLPLLAMAGAQRVELREELFAGPPDTEALTAAIQLQGLECVFSSPLELWREDGQLNPELEPTLRRAEACGAGWLKVSLGLLPEQPDLAALGRRLARHGLQLLVENDQTPQGGRIEVLERFFRLAERQQLDLAMTFDIGNWRWQEQAADEAALRLGRYVGYVHCKAVIRNRDGKLVAVPPSAADLQYWQRLLQHFPEGVARAIEYPLQGDDLLSLSRRHIAALARLGQ

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)