CutC-like (c.1.30.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: TIM beta/alpha-barrel
Superfamily: CutC-like
Family: CutC-like



Orphan Member
 
Domain: d1x8cb_ of protein: automated matches from Species: Shigella flexneri [TaxId: 198214]




>1x7ib1(c.1.30.1)
ALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRPRGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMPRMEKIMAAAGPLAVTFHRAFDMCANPLYTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVRAENLHHFLDAGVLEVHSSAGAWQASPMRYRNEYSRYIVDGAAVAEMKGIIERHQAK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)