Bee venom hyaluronidase (c.1.8.9)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: TIM beta/alpha-barrel
Superfamily: (Trans)glycosidases
Family: Bee venom hyaluronidase



Orphan Member
 
Domain: d2j88a_ of protein: automated matches from Species: Honeybee (Apis mellifera) [TaxId: 7460]




>1fcqa_(c.1.8.9)
EFNVYWNVPTFMCHKYGLRFEEVSEKYGILQNWMDKFRGEEIAILYDPGMFPALLVARNGGVPQLGNLTKHLQVFRDHLINQIPDKSFPGVGVIDFESWRPIFRQNWASLQPYKKLSVEVVRREHPFWDDQRVEQEAKRRFEKYGQLFMEETLKAAKRMRPAANWGYYAYPYCYNLTPNQPSAQCEATTMQENDKMSWLFESEDVLLPSVYLRWNLTSGERVGLVGGRVKEALRIARQMTTSRKKVLPYYWYKYQDRRDTDLSRADLEATLRKITDLGADGFIIWGSSDDINTKAKCLQFREYLNNELGPAVKR

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)