mRNA export factor tap (c.10.2.3)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
Superfamily: L domain-like
Family: mRNA export factor tap



Orphan Member
 
Domain: d3rw7d_ of protein: automated matches from Species: Human (Homo sapiens) [TaxId: 9606]




>1fo1a1(c.10.2.3)
ELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)