U2A'-like (c.10.2.4)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
Superfamily: L domain-like
Family: U2A'-like



Orphan Member
 
Domain: d1a9nc_ of protein: Splicesomal U2A' protein from Species: Human (Homo sapiens) [TaxId: 9606]




>1a9na_(c.10.2.4)
VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)