Hypothetical protein MW1667 (SA1546) (c.108.1.13)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: HAD-like
Superfamily: HAD-like
Family: Hypothetical protein MW1667 (SA1546)



Orphan Member
 
Domain: d1qyia_ of protein: Hypothetical protein MW1667 (SA1546) from Species: Staphylococcus aureus [TaxId: 1280]




>1qyia_(c.108.1.13)
MKKILFDVDGVFLSEERCFDVSALTVYELLMDKCYLGLHSHIDWETLTDNDIQDIRNRIFQKDKILNKLKSLGLNSNWDMLFIVFSIHLIDILKKLSHDEIEAFMYQDEPVELKLQNISTNLADCFNLNEQLPLQFLDNVKVGKNNIYAALEEFATTELHVSDATLFSLKGALWTLAQEVYQEWYLGSKLYEDVEKKIARTTFKTGYIYQEIILRPVDEVKVLLNDLKGAGFELGIATGRPYTETVVPFENLGLLPYFEADFIATASDVLEAENMYPQARPLGKPNPFSYIAALYGNNRDKYESYINKQDNIVNKDDVFIVGDSLADLLSAQKIGATFIGTLTGLKGKDAAGELEAHHADYVINHLGELRGVLDNLLEHH

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)