Molybdenum cofactor biosynthesis protein MoeB (c.111.1.1)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: Activating enzymes of the ubiquitin-like proteins
Superfamily: Activating enzymes of the ubiquitin-like proteins
Family: Molybdenum cofactor biosynthesis protein MoeB



Orphan Member
 
Domain: d1jwbb_ of protein: Molybdenum cofactor biosynthesis protein MoeB from Species: Escherichia coli [TaxId: 562]




>1jw9b_(c.111.1.1)
AELSDQEMLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIAITPVNALLDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVPLVSGAAIRMEGQITVFTYQDGEPCYRCLSRLFGEAGVMAPLIGVIGSLQAMEAIKMLAGYGKPASGKIVMYDAMTCQFREMKLMRNPGCEVCG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)