automated matches (c.118.1.0)


SCOP classification
 
Class: Alpha and beta proteins (a/b)
Fold: GckA/TtuD-like
Superfamily: GckA/TtuD-like
Family: automated matches



Orphan Member
 
Domain: d1x3la_ of protein: automated matches from Species: Pyrococcus horikoshii [TaxId: 70601]




>d1x3la_|c.118.1.0
MIAMDIREIGLRLVGEAIKAADPYRAVLNAVKVSDDKIIVQGKEFEIKGKVYVIALGKAA
CEMARAIEDILDVEDGVAVTKYGYGKELKRIKVIEAGHPIPDEKSILGAKEALSILNRAR
ENDIVFILISGGGSALFELPEEGISLEDLKLTTDLLLKSGAKIHEINTVRKHISKVKGGK
LAKMIKGTGIVLIISDVVGDNLEAIASGPTVKDPTTFEDAKRILELYDIWEKVPESVRLH
IERGLRGEVEETLKEDLPNVHNFLIASNSISCEAIAREAQRLGFKAYIMTTTLEGEAKDA
GLFIGSIVQEIAERGRPFEPPVVLVFGGETTVTIEGKGGKGGPNQEIALSATRKISDLEA
LIVAFDTDGTDGPTDAAGGIVDGTTYKKLREKGIDVEKVLKEHNSYEALKKVGGLLFTGP
TGTNVNSIVIAIVTSK

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)